BUKLYN LIMITED.
BUKLYN LIMITED.
ACCESSORIES
Rasch
Rasch Maya Floral Pink / Navy Wallpaper - Modern Contemporary Feature Wall - All Rooms
bedroomdining-roomhallway-stairsliving-roomnavypaperraschwallpaper
Rasch Maya Floral Pink / Navy Wallpaper - Modern Contemporary Feature Wall - All Rooms
Sold Out
Sold out
Rasch Maya Floral Pink / Navy Wallpaper - Modern Contemporary Feature Wall - All Rooms
Sold Out
Rasch Akari Madagascar Leaf Olive Green/Purple Wallpaper 282886 - All Rooms
bedroomdining-roomgreenhallway-stairsliving-roompaperpurpleraschwallpaper
Rasch Akari Madagascar Leaf Olive Green/Purple Wallpaper 282886 - All Rooms
from
£1.99
Rasch Akari Madagascar Leaf Olive Green/Purple Wallpaper 282886 - All Rooms
from
£1.99
Akari Kyoto Cranes Floral Wallpaper Navy Blue/Magenta Pink Rasch 282763 - All Rooms
bedroombluedining-roomhallway-stairsliving-roomnavypaperraschwallpaper
Akari Kyoto Cranes Floral Wallpaper Navy Blue/Magenta Pink Rasch 282763 - All Rooms
from
£1.99
£15.99
Sale
Akari Kyoto Cranes Floral Wallpaper Navy Blue/Magenta Pink Rasch 282763 - All Rooms
from
£1.99
£15.99
Rasch Wallpaper 553352 - Colourful Non-Woven Wallpaper from The Salisbury Collection with Different Coloured Leaves on Dark Blue Background with Slight Structure - 10.05 m x 53 cm (L x W)
blueleaves-and-trees-1navynon-wovenpaperraschredwallpaper
Rasch Wallpaper 553352 - Colourful Non-Woven Wallpaper from The Salisbury Collection with Different Coloured Leaves on Dark Blue Background with Slight Structure - 10.05 m x 53 cm (L x W)
Sold Out
Sold out
Rasch Wallpaper 553352 - Colourful Non-Woven Wallpaper from The Salisbury Collection with Different Coloured Leaves on Dark Blue Background with Slight Structure - 10.05 m x 53 cm (L x W)
Sold Out
Rasch Paloma Feather Leaf Trail Pink Glitter Motif Luxury Embossed Metallic Wallpaper Paste The Wall Vinyl - All Rooms
bedroomdining-roomembossedfeatherhallway-stairsliving-roommetallicpaperpaste-the-wallraschvinylwallpaper
Rasch Paloma Feather Leaf Trail Pink Glitter Motif Luxury Embossed Metallic Wallpaper Paste The Wall Vinyl - All Rooms
from
£1.99
Rasch Paloma Feather Leaf Trail Pink Glitter Motif Luxury Embossed Metallic Wallpaper Paste The Wall Vinyl - All Rooms
from
£1.99
Rasch Wallpaper 553338 - Colourful Non-Woven Wallpaper from The Salisbury Collection with Different Coloured Leaves on White Background with Slight Structure - 10.05 m x 53 cm (L x W)
leaves-and-trees-1non-wovenpaperraschredwallpaperwhite
Rasch Wallpaper 553338 - Colourful Non-Woven Wallpaper from The Salisbury Collection with Different Coloured Leaves on White Background with Slight Structure - 10.05 m x 53 cm (L x W)
£12.99
Rasch Wallpaper 553338 - Colourful Non-Woven Wallpaper from The Salisbury Collection with Different Coloured Leaves on White Background with Slight Structure - 10.05 m x 53 cm (L x W)
£12.99
Rasch Maya Willow Woodland Trees Birds Navy Wallpaper - Green Naturistic Floral - Modern Contemporary Feature Wall
birds-and-butterflygreenleaves-and-trees-1navypaperraschwallpaperwood-and-panelwood-effect
Rasch Maya Willow Woodland Trees Birds Navy Wallpaper - Green Naturistic Floral - Modern Contemporary Feature Wall
Sold Out
Sold out
Rasch Maya Willow Woodland Trees Birds Navy Wallpaper - Green Naturistic Floral - Modern Contemporary Feature Wall
Sold Out
RASCH (U.K) Limited Dimension Large Floral Wallpaper - Modern Wallpaper for Living Room, Bedroom, Fireplace - Decorative Luxury Nature Wall Paper with Delicately Illustrated Flowers (Pink/Musky Blue)
bedroomblueliving-roomnavypaperraschwallpaper
RASCH (U.K) Limited Dimension Large Floral Wallpaper - Modern Wallpaper for Living Room, Bedroom, Fireplace - Decorative Luxury Nature Wall Paper with Delicately Illustrated Flowers (Pink/Musky Blue)
Sold Out
Sold out
RASCH (U.K) Limited Dimension Large Floral Wallpaper - Modern Wallpaper for Living Room, Bedroom, Fireplace - Decorative Luxury Nature Wall Paper with Delicately Illustrated Flowers (Pink/Musky Blue)
Sold Out
RASCH (U.K) Limited Horizon Wallpaper - Modern Wallpaper for Living Room, Bedroom, Fireplace - Decorative Luxury Wall Paper with Landscape Design & Natural Tones (Metallic Silver & Gold)
bedroomgoldliving-roommetallicnaturalpaperraschsilverwallpaper
RASCH (U.K) Limited Horizon Wallpaper - Modern Wallpaper for Living Room, Bedroom, Fireplace - Decorative Luxury Wall Paper with Landscape Design & Natural Tones (Metallic Silver & Gold)
£9.99
RASCH (U.K) Limited Horizon Wallpaper - Modern Wallpaper for Living Room, Bedroom, Fireplace - Decorative Luxury Wall Paper with Landscape Design & Natural Tones (Metallic Silver & Gold)
£9.99
Rasch paperhangings 448610 Non-Woven Wallpaper Collection Florentine
non-wovenpaperraschwallpaper
Rasch paperhangings 448610 Non-Woven Wallpaper Collection Florentine
£12.99
Rasch paperhangings 448610 Non-Woven Wallpaper Collection Florentine
£12.99
Rasch Tapeten Non Woven Wallpaper (Exotic) Rosa 10,05 m x 0,53 m Club Botanique + Claas II 538953
non-wovenpaperraschwallpaper
Rasch Tapeten Non Woven Wallpaper (Exotic) Rosa 10,05 m x 0,53 m Club Botanique + Claas II 538953
Sold Out
Sold out
Rasch Tapeten Non Woven Wallpaper (Exotic) Rosa 10,05 m x 0,53 m Club Botanique + Claas II 538953
Sold Out
RASCH (U.K) Limited Amara Linen Wallpaper - Modern Wallpaper for Living Room, Bedroom, Fireplace - Decorative Luxury Wall Paper with Realistic Textile Thread Effect & Subtle Gold Glimmer (Beige)
bedroombeigegoldliving-roompaperraschtilewallpaper
RASCH (U.K) Limited Amara Linen Wallpaper - Modern Wallpaper for Living Room, Bedroom, Fireplace - Decorative Luxury Wall Paper with Realistic Textile Thread Effect & Subtle Gold Glimmer (Beige)
from
£1.99
RASCH (U.K) Limited Amara Linen Wallpaper - Modern Wallpaper for Living Room, Bedroom, Fireplace - Decorative Luxury Wall Paper with Realistic Textile Thread Effect & Subtle Gold Glimmer (Beige)
from
£1.99
Join our VIP Club today and get 15% off your first order
Subscribe to our newsletter for sneak peeks at new collections and early access to flash sales!