BUKLYN LIMITED.
BUKLYN LIMITED.
ACCESSORIES
Rasch
Rasch Wallpaper 542325 Shimmering Stripe Beige Gold
beigegoldpaperraschstripedwallpaper
Rasch Wallpaper 542325 Shimmering Stripe Beige Gold
£14.99
Rasch Wallpaper 542325 Shimmering Stripe Beige Gold
£14.99
Rasch Maya Floral Pink / Navy Wallpaper - Modern Contemporary Feature Wall - All Rooms
bedroomdining-roomhallway-stairsliving-roomnavypaperraschwallpaper
Rasch Maya Floral Pink / Navy Wallpaper - Modern Contemporary Feature Wall - All Rooms
from
£1.99
Rasch Maya Floral Pink / Navy Wallpaper - Modern Contemporary Feature Wall - All Rooms
from
£1.99
Rasch Paloma Feather Leaf Trail Pink Glitter Motif Luxury Embossed Metallic Wallpaper Paste The Wall Vinyl - All Rooms
bedroomdining-roomembossedfeatherhallway-stairsliving-roommetallicpaperpaste-the-wallraschvinylwallpaper
Rasch Paloma Feather Leaf Trail Pink Glitter Motif Luxury Embossed Metallic Wallpaper Paste The Wall Vinyl - All Rooms
from
£1.99
Rasch Paloma Feather Leaf Trail Pink Glitter Motif Luxury Embossed Metallic Wallpaper Paste The Wall Vinyl - All Rooms
from
£1.99
Rasch Brick Lane 427332 Non-Woven Wallpaper Industrial Green 10.05 m x 0.53 m
brick-stone-and-slate-1greennon-wovenpaperraschwallpaper
Rasch Brick Lane 427332 Non-Woven Wallpaper Industrial Green 10.05 m x 0.53 m
£12.99
Rasch Brick Lane 427332 Non-Woven Wallpaper Industrial Green 10.05 m x 0.53 m
£12.99
Rasch Portfolio Marble Cube Geometric Grey Wallpaper 248975 - All Rooms
bedroomdining-roomgeometricgreyhallway-stairsliving-roommarble-effectspaperraschwallpaper
Rasch Portfolio Marble Cube Geometric Grey Wallpaper 248975 - All Rooms
Sold Out
Sold out
Rasch Portfolio Marble Cube Geometric Grey Wallpaper 248975 - All Rooms
Sold Out
Rasch Vasari Marble Taupe Wallpaper 529456
bedroommarble-effectspaperraschtaupewallpaper
Rasch Vasari Marble Taupe Wallpaper 529456
from
£1.99
Rasch Vasari Marble Taupe Wallpaper 529456
from
£1.99
Rasch Wallpaper 553130 - Colourful Non-Woven Wallpaper from The Salisbury Collection with Flower Motif in Various Colours on White Background with Slightly Structure - 10.05 m x 53 cm (L x W)
non-wovenpaperraschwallpaperwhite
Rasch Wallpaper 553130 - Colourful Non-Woven Wallpaper from The Salisbury Collection with Flower Motif in Various Colours on White Background with Slightly Structure - 10.05 m x 53 cm (L x W)
£10.99
Rasch Wallpaper 553130 - Colourful Non-Woven Wallpaper from The Salisbury Collection with Flower Motif in Various Colours on White Background with Slightly Structure - 10.05 m x 53 cm (L x W)
£10.99
Rasch Tapeten Vliestapete (universell) Rosa 10,05 m x 0,53 m Poetry 424003
rasch
Rasch Tapeten Vliestapete (universell) Rosa 10,05 m x 0,53 m Poetry 424003
£12.99
Rasch Tapeten Vliestapete (universell) Rosa 10,05 m x 0,53 m Poetry 424003
£12.99
Rasch Geometric Grey Wood Effect Wallpaper Metallic Copper Modern
coppergeometricgreymetallicpaperraschwallpaperwood-and-panelwood-effect
Rasch Geometric Grey Wood Effect Wallpaper Metallic Copper Modern
£12.99
Rasch Geometric Grey Wood Effect Wallpaper Metallic Copper Modern
£12.99
Rasch Vasari Marble Natural & Rust Wallpaper 529418
marble-effectsnaturalpaperraschwallpaper
Rasch Vasari Marble Natural & Rust Wallpaper 529418
from
£1.99
Rasch Vasari Marble Natural & Rust Wallpaper 529418
from
£1.99
Rasch Vasari Valentina Floral Wallpaper � 526875 � Grey/Black
black-1greypaperraschwallpaper
Rasch Vasari Valentina Floral Wallpaper � 526875 � Grey/Black
£27.99
Rasch Vasari Valentina Floral Wallpaper � 526875 � Grey/Black
£27.99
Rasch Wallpaper 553352 - Colourful Non-Woven Wallpaper from The Salisbury Collection with Different Coloured Leaves on Dark Blue Background with Slight Structure - 10.05 m x 53 cm (L x W)
blueleaves-and-trees-1navynon-wovenpaperraschredwallpaper
Rasch Wallpaper 553352 - Colourful Non-Woven Wallpaper from The Salisbury Collection with Different Coloured Leaves on Dark Blue Background with Slight Structure - 10.05 m x 53 cm (L x W)
£10.99
Rasch Wallpaper 553352 - Colourful Non-Woven Wallpaper from The Salisbury Collection with Different Coloured Leaves on Dark Blue Background with Slight Structure - 10.05 m x 53 cm (L x W)
£10.99
Join our VIP Club today and get 15% off your first order
Subscribe to our newsletter for sneak peeks at new collections and early access to flash sales!